DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ferd3l

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus


Alignment Length:110 Identity:26/110 - (23%)
Similarity:46/110 - (41%) Gaps:33/110 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FNDDEESSSAFNG----PSVIRR---------------NARERNRVKQVNNGFSQLRQHIPAAVI 56
            :.|.||......|    .|::.|               |.|||.|:..:|..|.|||:.:|....
Mouse    71 YEDPEEEEEEGEGRGRVASLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAY 135

  Fly    57 ADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQK 101
                          .|:||::.||::|:.||..:.::|...::::
Mouse   136 --------------EKRLSRIETLRLAIVYISFMTELLQSKEEKE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 20/65 (31%)
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88 4/16 (25%)
bHLH domain 104..159 19/68 (28%)
HLH 104..156 CDD:278439 19/65 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.