DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and ascl2

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_002940290.3 Gene:ascl2 / 100494131 XenbaseID:XB-GENE-6458615 Length:236 Species:Xenopus tropicalis


Alignment Length:69 Identity:39/69 - (56%)
Similarity:45/69 - (65%) Gaps:13/69 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQK 92
            |||.|||||||.||.||::||||:|.|             .|.|||:|||.||:.||||||.||.
 Frog   115 RRNERERNRVKLVNLGFAKLRQHVPQA-------------QGPNKKMSKVETLRSAVEYIRALQS 166

  Fly    93 VLHE 96
            :|.|
 Frog   167 ILME 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 36/65 (55%)
ascl2XP_002940290.3 bHLH_TS_ASCL2_Mash2 110..174 CDD:381586 39/69 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9148
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I4952
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm9527
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.