powered by:
Protein Alignment ac and ascl2
DIOPT Version :9
Sequence 1: | NP_476824.1 |
Gene: | ac / 30981 |
FlyBaseID: | FBgn0000022 |
Length: | 201 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002940290.3 |
Gene: | ascl2 / 100494131 |
XenbaseID: | XB-GENE-6458615 |
Length: | 236 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 39/69 - (56%) |
Similarity: | 45/69 - (65%) |
Gaps: | 13/69 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 RRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQK 92
|||.|||||||.||.||::||||:|.| .|.|||:|||.||:.||||||.||.
Frog 115 RRNERERNRVKLVNLGFAKLRQHVPQA-------------QGPNKKMSKVETLRSAVEYIRALQS 166
Fly 93 VLHE 96
:|.|
Frog 167 ILME 170
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
72 |
1.000 |
Domainoid score |
I9148 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
91 |
1.000 |
Inparanoid score |
I4952 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1131543at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001993 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9527 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3926 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 7.000 |
|
Return to query results.
Submit another query.