DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and tal1

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001135468.1 Gene:tal1 / 100196924 XenbaseID:XB-GENE-479827 Length:388 Species:Xenopus tropicalis


Alignment Length:213 Identity:55/213 - (25%)
Similarity:83/213 - (38%) Gaps:80/213 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGSENHSVFNDDEESSSAF------------------NGP--SVIRR---NARERNRVKQVNNGF 44
            |.|.|...| ||.|:...|                  .||  .|:||   |:|||.|.:.||..|
 Frog   213 LASGNSGYF-DDPEAYPMFTNNSRVKRRPGPYEVEISEGPQTKVVRRIFTNSRERWRQQNVNGAF 276

  Fly    45 SQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQKQKQLHLQQ 109
            ::||:.||.              ...:|||||...|::|::||..|.|:|  :||:::..     
 Frog   277 AELRKLIPT--------------HPPDKKLSKNEILRLAMKYINFLAKLL--DDQEEEGN----- 320

  Fly   110 QHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATSTIPGATPPNNFHTKLEASFE 174
                 |:.:.::......||| ||......|||.          |::.|...|:::         
 Frog   321 -----QRNKGNKDNGMVQQEL-LQDMLSPNSSCG----------SSLDGVPSPDSY--------- 360

  Fly   175 DYRNNSCSSGTEDEDILD 192
                      :|:.|.||
 Frog   361 ----------SEEHDTLD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 24/65 (37%)
tal1NP_001135468.1 PHA03247 <6..195 CDD:223021
bHLH_TS_TAL1 254..318 CDD:381549 29/79 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.