DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and mespbb

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001252536.1 Gene:mespbb / 100148845 ZFINID:ZDB-GENE-110609-1 Length:244 Species:Danio rerio


Alignment Length:207 Identity:44/207 - (21%)
Similarity:76/207 - (36%) Gaps:64/207 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SENHSVFNDDEESSSAF---------------NGPSVIRRNA--RERNRVKQVNNGFSQLRQHIP 52
            ::..||....|.|.|:|               ..||..|::|  :|:.|::.:......||.::|
Zfish    43 AQAQSVSPKPEISGSSFQDGGRSRVGVRRTRCKNPSKQRQSASEKEKLRMRDLTKALHHLRTYLP 107

  Fly    53 AAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRL--QKVLHENDQQKQKQLHLQQQHLHFQ 115
            .:|..            ..:.|:|:.||::.:.||..|  |..|.|....|.:.|.:.    .:|
Zfish   108 PSVAP------------VGQTLTKIETLRLTIRYISYLSAQLGLSEESLCKMRDLRVS----GYQ 156

  Fly   116 QQQQHQHLYA----WHQELQLQSPTGS-TSSCNSISSYCK----PATSTIPGATPPNNFHTKLEA 171
            :..|: |.|:    |          || .:||.:..|..:    .......|...|         
Zfish   157 EMPQN-HCYSTAEFW----------GSCQNSCGTSESVLRRTDMDCRQVFMGMEKP--------- 201

  Fly   172 SFEDYRNNSCSS 183
            :::|..|:|..|
Zfish   202 AYDDSFNSSSES 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 16/69 (23%)
mespbbNP_001252536.1 HLH 80..133 CDD:278439 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.