DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment y and RGN

DIOPT Version :9

Sequence 1:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_004674.1 Gene:RGN / 9104 HGNCID:9989 Length:299 Species:Homo sapiens


Alignment Length:197 Identity:42/197 - (21%)
Similarity:67/197 - (34%) Gaps:60/197 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IPQNA----LPVGVEHFGNRLFVTVP-----RWRDGIPATLTYINMD--------RSLTGSPELI 101
            :|:|.    .||..|...:.|||.:|     || |.....:..:.||        |...|....|
Human    10 LPENCRCGESPVWEEVSNSLLFVDIPAKKVCRW-DSFTKQVQRVTMDAPVSSVALRQSGGYVATI 73

  Fly   102 PYP----DWRSNTA-------GDCANSITTAYRI---KVDECGRLWVLDTGTVGIGNTTTNPCPY 152
            ...    :|:..:|       .|..|:     |.   |||..||.:.        |.......|.
Human    74 GTKFCALNWKEQSAVVLATVDNDKKNN-----RFNDGKVDPAGRYFA--------GTMAEETAPA 125

  Fly   153 AVN-----VFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIGKNCDDAYAYFADELGYGLIAYSW 212
            .:.     ::.|..|..:::| ...||         |:..:..:.|....|:.|.|.|.:.|:.:
Human   126 VLERHQGALYSLFPDHHVKKY-FDQVD---------ISNGLDWSLDHKIFYYIDSLSYSVDAFDY 180

  Fly   213 EL 214
            :|
Human   181 DL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yNP_476792.1 MRJP 119..405 CDD:308585 21/104 (20%)
RGNNP_004674.1 SGL 16..264 CDD:400653 40/191 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.