DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment y and yellow-k

DIOPT Version :9

Sequence 1:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:401 Identity:80/401 - (19%)
Similarity:145/401 - (36%) Gaps:111/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GWILVTLITLVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFG--- 67
            |:::|.|| |.|.:|.                     |.:..|....|        .|.|..   
  Fly    10 GFLIVGLI-LATDAWL---------------------LSESGLNESSY--------KVRHLSMHF 44

  Fly    68 NRLFVTVPRWRDGIPATLTYINMDRSLTGSPELI-PYPDWRSNTAGDCANSITTAYRIKVDECGR 131
            :|:|::|....:..| ||.......|....|.:: |:.|..|....|..:.:..|:..:||...|
  Fly    45 SRVFLSVNVESNDAP-TLIEAQWPVSYFPMPTVVFPHIDVHSMGDHDDCSLVQQAHWSQVDALSR 108

  Fly   132 LWVLDTGTVGIGNTTTNPCPYAVNVFDLTTDTRIRRYELPGVD------TNPNTFIANIAVDIG- 189
            |||:|.|..|      :.|...:.||||..:..    ||..:|      .|...|   :.|.:| 
  Fly   109 LWVMDIGFPG------STCSPRLFVFDLMRNNA----ELLRIDCGHHIGANDTHF---LTVQMGP 160

  Fly   190 --KNCD-DAYAYF-----ADELGYGLIAYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGE 246
              ..|: :.:.||     .:.|.|.::..:|.     |.|..|..: :.:...|.:..::|.:|.
  Fly   161 KSPGCEHERHIYFILGKVPEILAYDILEQTWH-----RLSLESNKY-ENMNQSFPIKPVDFIFGI 219

  Fly   247 EGIFGMSLSPIRSDGYRTLYFSPLASHRQFAVSTRILRDETRTEDSYHDFVALDERGPNSHTTSR 311
            :|  .:.||....|.|.|:....:....:.|            ....::.:.|...|....::..
  Fly   220 QG--ELILSDQDGDLYSTVDRLEIEGKSELA------------SKPINNSIKLTHLGSLLGSSRS 270

  Fly   312 VMSDDGIELFNLIDQNAVGCWHSSMPYSPQFHGIV----------DRDDVGLVFPADVK---IDE 363
            ::.|:...|:.:|               |:|..:|          :.:::..:...:::   ...
  Fly   271 MIIDNFGTLYYVI---------------PKFGAVVRCAKLANITAEGNEIIYITSKNIQQIFFTS 320

  Fly   364 NKNVWVLSDRM 374
            |..:||||||:
  Fly   321 NDALWVLSDRV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yNP_476792.1 MRJP 119..405 CDD:308585 56/284 (20%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.