DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment y and yellow-g

DIOPT Version :9

Sequence 1:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster


Alignment Length:319 Identity:80/319 - (25%)
Similarity:138/319 - (43%) Gaps:44/319 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTVPRWRDGIPATLTYI 88
            :|..:.|.|.|.:...:|  |:..:.||.|:|:|.:....:...:..||.:||::.|:|.||..:
  Fly    46 ELTFQLSGSSLHWPCEST--KNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKV 108

  Fly    89 NMDRS--LTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDTGTVGIGNTTTNP-- 149
            |:.:.  ||   ::.|||.|.....|:| .::.:...|.||:.|.||.||   |||.||...|  
  Fly   109 NLKKGECLT---KIAPYPCWAIQEEGNC-QALQSVVDIAVDQNGLLWALD---VGIVNTLEQPIR 166

  Fly   150 -CPYAVNVFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIGKNCDDAYAYFADELGYGLIAYSWE 213
             |...:...:......::..:|..:.|:.:. :..|.||..|: :..:.|.||.....::.|...
  Fly   167 RCSPKIVAINTANHKVVKSIDLSDLVTSESR-LQFIVVDYSKD-NKPFVYVADAGARSILVYDIT 229

  Fly   214 LNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLSPIRSDGYRTLYFSPLASHRQFAV 278
            .|||:|........|                 ...:..::|:. :.||..||:||.|:|.|.:::
  Fly   230 GNKSYRIVLPKATAP-----------------TSDVLYVALTS-KPDGTSTLFFSYLSSPRLYSI 276

  Fly   279 STRILRDETRTEDSYHDFVALDERGPNSHTTSRVM--SDDGIEL-FNLIDQNAVGCWHS 334
            ....||......       ::.:.||..:....|:  :|.|..| |....:|.:..|.|
  Fly   277 KGEYLRVGQGAG-------SIIDVGPKPYGKQAVLLGADGGTSLFFRYKGENDIYLWDS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yNP_476792.1 MRJP 119..405 CDD:308585 52/222 (23%)
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 52/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.