DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment y and yellow-d

DIOPT Version :9

Sequence 1:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster


Alignment Length:397 Identity:114/397 - (28%)
Similarity:187/397 - (47%) Gaps:67/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WSQLDFAFPNTRLKDQALASGDYIPQNALPVGV--EHFGN---RLFVTVPRWRDGIPATLTYINM 90
            |.||:|.||..:.::.|.|:|:.:|:|..|:.|  ::..|   |||.|:||:..|||.||..::.
  Fly    40 WGQLEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVTGIPYTLATVSA 104

  Fly    91 DRSLTGSPELIPYPD--WRSNTAGDCANSITTAYRIKVDECGRLWVLDTGTVGIGNTTTNPCPYA 153
            .:...| |.|.|||:  |.:....|| :.||:|:|:.:.||.::||:|:|.:|    ||..||..
  Fly   105 TQGRNG-PLLQPYPNYSWHNANGEDC-DRITSAFRVAITECNQMWVIDSGVIG----TTQLCPPQ 163

  Fly   154 VNVFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIGKN-----------CDDAYAYFADELGYGL 207
            :..|.|.||..:.|:..|.     :|:|.:.::.|..|           |.....|.||...:||
  Fly   164 LLQFALATDRLLHRFRFPN-----DTYIPSGSLFITPNVLVQDPPPRGTCSRTMIYVADVSYHGL 223

  Fly   208 IAYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLSPIRSDGYRTLYFSPLAS 272
            :.|..:...||| :.:.:.:|||..|...:||.:| :..:|:|.:      ::..|.|||.||||
  Fly   224 VVYDHQAQTSWR-AENRFMYPDPDYGKHTIAGESF-YLMDGMFAL------NNDKRNLYFHPLAS 280

  Fly   273 HRQFAVSTRILRDETR----TEDSYHDFVALDERGPNSHTTSRVMSDDGIELFNLIDQNAVGC-- 331
            ..:::|....|..:..    .|....:|..|..|    .:.....:.||        :|.|.|  
  Fly   281 ASEYSVPLSALNRQQNWANGPEALPEEFRLLGRR----RSECAASAIDG--------RNNVYCVT 333

  Fly   332 --------WHSSMPYSPQFHGIVDRDDVGLVFPADVKIDENK----NVWVLSDRMPVFLLSDLDY 384
                    |:.:.||:.:..|.:......|.|.:.:|:..|:    .:|:||:|........|:.
  Fly   334 FNPVKLFVWNVNSPYNSRNFGNLPAKSDDLQFVSGMKVLRNREGQEELWMLSNRYQKIAAGTLNS 398

  Fly   385 SDTNFRI 391
            .:.||||
  Fly   399 KEVNFRI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yNP_476792.1 MRJP 119..405 CDD:308585 79/302 (26%)
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 79/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449214
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D202564at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.