DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment y and Rgn

DIOPT Version :9

Sequence 1:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn / 19733 MGIID:108024 Length:299 Species:Mus musculus


Alignment Length:185 Identity:38/185 - (20%)
Similarity:64/185 - (34%) Gaps:52/185 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PVGVEHFGNRLFVTVP-----RW--------RDGIPATLTYINMDRSLTGSPELIPYP----DWR 107
            ||..|...:.|||.:|     ||        |..:.|.::.:.: |.|.|....|...    :|.
Mouse    20 PVWEEASQSLLFVDIPSKIICRWDTVSNQVQRVAVDAPVSSVAL-RQLGGYVATIGTKFCALNWE 83

  Fly   108 SNTAGDCA--------NSITTAYRIKVDECGRLWVLDTGTVGIGNTTTNPCPYAV-----NVFDL 159
            :.:....|        |.....   |||..||.:.        |.......|..:     :::.|
Mouse    84 NQSVFVLAMVDEDKKNNRFNDG---KVDPAGRYFA--------GTMAEETAPAVLERHQGSLYSL 137

  Fly   160 TTDTRIRRYELPGVDTNPNTFIANIAVDIGKNCDDAYAYFADELGYGLIAYSWEL 214
            ..|..:::| ...||         |:..:..:.|....|:.|.|.|.:.|:.::|
Mouse   138 FPDHSVKKY-FDQVD---------ISNGLDWSLDHKIFYYIDSLSYTVDAFDYDL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yNP_476792.1 MRJP 119..405 CDD:308585 20/101 (20%)
RgnNP_033086.1 SGL 16..264 CDD:400653 38/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.