DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or98a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:353 Identity:66/353 - (18%)
Similarity:119/353 - (33%) Gaps:103/353 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CTVCAFMVQNRNQIVLCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEW 117
            ||.....|:....:|.|::|.:. .|.:.:...::.||:.:.. ..|..:|.:||.:    ..|.
  Fly   119 CTTLKERVEVHQGVVRCNKAYLI-YQFIYTAYTISTFLSAALS-GKLPWRIYNPFVD----FRES 177

  Fly   118 RSQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAM 182
            ||.           |...|....:.:|..|..|::.                        .:|.:
  Fly   178 RSS-----------FWKAALNETALMLFAVTQTLMS------------------------DIYPL 207

  Fly   183 DCCLMVFVLSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPS-CFNPSRSDFGLSGIFVEH 246
                                 ||| ..|.|.|:..||     |:.| |.:..:||       .|:
  Fly   208 ---------------------LYG-LILRVHLKLLRL-----RVESLCTDSGKSD-------AEN 238

  Fly   247 AR-LLKIVQHFNY----------SFMEIAFVEVVI--ICGLYCSVICQYIMPHTNQNFAFLGFFS 298
            .: |:|.::..|.          :.....||:.::  || |..|:|............|.:.:.:
  Fly   239 EQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGIC-LGLSMINLLFFADIWTGLATVAYIN 302

  Fly   299 --LVVTTQLCIYLFGAEQVRLEAERFSRLLYEVI---PWQNLPPKHRKLFLFPIERAQRETVLGA 358
              :|.|...|   |..:.::.:.|    ||...|   .|.|....::....:.::.||:.....|
  Fly   303 GLMVQTFPFC---FVCDLLKKDCE----LLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTA 360

  Fly   359 -YFFELGRPLLVWIFRTAGSFTTLMNAL 385
             ..|.:.....:.:.:.|.|..|.:|.|
  Fly   361 GSIFPISTGSNIKVAKLAFSVVTFVNQL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 54/316 (17%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 61/342 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.