DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or94a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:398 Identity:84/398 - (21%)
Similarity:147/398 - (36%) Gaps:94/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLGNLWTQRFTFARMGLDLQPDKKGNVLRSPLLYCIMCLTTSFELCTVCAFMVQNRNQIVLCSEA 72
            |:|.:|.:.|..:.:      ::.|.||              :...|..|.:|:..:.....:||
  Fly    56 FIGLMWLEAFISSNL------EQAGQVL--------------YMSITEMALVVKILSIWHYRTEA 100

  Fly    73 --LMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQNQRGQLMAAIYFMMC 135
              ||:.||....      :...:.:.||.                 ||.:.:..:....||.::.
  Fly   101 WRLMYELQHAPD------YQLHNQEEVDF-----------------WRREQRFFKWFFYIYILIS 142

  Fly   136 AG------TSVSFL---LMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAMDCCLMVFVL 191
            .|      |.|.||   .:|.|     |:...|:.....:.....||:..              :
  Fly   143 LGVVYSGCTGVLFLEGYELPFA-----YYVPFEWQNERRYWFAYGYDMAG--------------M 188

  Fly   192 SFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLSGIFVEHARL------- 249
            :..|.|...:|||..:....:||.||.||.:|:...:..|.:.....|..||:.|.|:       
  Fly   189 TLTCISNITLDTLGCYFLFHISLLYRLLGLRLRETKNMKNDTIFGQQLRAIFIMHQRIRSLTLTC 253

  Fly   250 LKIVQHFNYSFMEIAFVEVVIICGLYCSVICQY--IMPHTNQNFAFLGFFSLVVTTQLCIYL--F 310
            .:||..:   .:....:..:|||  :.....|:  |..:..|..:.|.|.|:::   |.|||  :
  Fly   254 QRIVSPY---ILSQIILSALIIC--FSGYRLQHVGIRDNPGQFISMLQFVSVMI---LQIYLPCY 310

  Fly   311 GAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRE-TVLGAYFFELGRPLLVWIFRT 374
            ...::.:.|.:.:..:|.. .|....|..|||....:|..::. |:....||.:|.|:.|.....
  Fly   311 YGNEITVYANQLTNEVYHT-NWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINN 374

  Fly   375 AGSFTTLM 382
            |.||..|:
  Fly   375 AYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 64/317 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 76/377 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.