DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or88a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:372 Identity:86/372 - (23%)
Similarity:139/372 - (37%) Gaps:104/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NRNQIVLCSEALMHGLQMVSSLLKMAIFLAKSHDLV------------DLIQQIQSPFTEEDLVG 114
            |:|..||       .:.:..|:..:.::| |..::|            ||:.|:.....|     
  Fly    78 NQNPPVL-------SITIYFSIRGLMLYL-KRKEIVEFVNDLDRECPRDLVSQLDMQMDE----- 129

  Fly   115 TEWRSQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVL----LPYDVT 175
             .:|:..||.:.: .||..:   ....|.::|:||.:|.:.  |:..||:....|    ||..|.
  Fly   130 -TYRNFWQRYRFI-RIYSHL---GGPMFCVVPLALFLLTHE--GKDTPVAQHEQLLGGWLPCGVR 187

  Fly   176 Q-PHVYAMDCCLMVFVLSF-FCCSTTGV------DTLYGWCALGVSLQYRRLGQQLKRIPSCFNP 232
            : |:.|       :.|.|| ..|:|.||      |.|:......:.:....|.:|.    |..:|
  Fly   188 KDPNFY-------LLVWSFDLMCTTCGVSFFVTFDNLFNVMQGHLVMHLGHLARQF----SAIDP 241

  Fly   233 SRSDFGLSGIFVEHARLL------------KIVQHFNYSFMEIAFVEVVIICGLY---------C 276
            .:|.......||: .|||            |....|..:|:...||....:| .|         .
  Fly   242 RQSLTDEKRFFVD-LRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLC-FYLFMLSETSDV 304

  Fly   277 SVICQYIMPHTNQNFAFLGFFSLVVTTQLCIYLFGAEQVR--LEAERFSRLLYEVIPWQNLPPKH 339
            .:|.|||:|    ....:||     |.::|:.....|:..  ||:...|:      .|.....::
  Fly   305 LIIAQYILP----TLVLVGF-----TFEICLRGTQLEKASEGLESSLRSQ------EWYLGSRRY 354

  Fly   340 RKLFLFPIERAQRETVLGAYFFELGRPLLVWIFRTAGSFTTLMNALY 386
            ||.:|...:..||...|||  |.|.:..:|       .||.:|...|
  Fly   355 RKFYLLWTQYCQRTQQLGA--FGLIQVNMV-------HFTEIMQLAY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 78/343 (23%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 85/370 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.