DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or85d

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:272 Identity:53/272 - (19%)
Similarity:95/272 - (34%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 AIYFMMCAGTSVSFLL-MPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAM---------D 183
            |:|:::|     .|.| |.....||.|:            ..:|:|.:..:.|..         .
  Fly   168 AVYYLVC-----DFWLGMRQFERMLPYY------------CWVPWDWSTGYSYYFMYISQNIGGQ 215

  Fly   184 CCLMVFVLSFFCCSTTGVDTLYGWCALG--VSLQYRRLGQQLKRIPSCFNPSRSDFG-LSGIFVE 245
            .||         ......|.|  .|||.  |.:.:.||...::...:.....:.|.. |......
  Fly   216 ACL---------SGQLAADML--MCALVTLVVMHFIRLSAHIESHVAGIGSFQHDLEFLQATVAY 269

  Fly   246 HARLLKIVQHFNYSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFLGFFSLVVTTQLCIYLF 310
            |..|:.:.|..|..|........|....:.|.|..|..:.....|...|..|......|:.:...
  Fly   270 HQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIAT 334

  Fly   311 GAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGA-YFFELGRPLLVWIFRT 374
            .|:::...:|:..:.:|. ..|.....::||:.:..|:|||:.:.|.| .|..:....:..:.:.
  Fly   335 HAQRLVDASEQIGQAVYN-HDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQL 398

  Fly   375 AGSFTTLMNALY 386
            :..|..|:..:|
  Fly   399 SYKFFALLRTMY 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 50/260 (19%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 50/260 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.