DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or85b

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:170 Identity:35/170 - (20%)
Similarity:64/170 - (37%) Gaps:54/170 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 HARLLKIVQHFN--------YSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFLGF------ 296
            |.|:|::....|        .:||..:|            |||            |:||      
  Fly   248 HERILRLSDAVNDIFGIPLLLNFMVSSF------------VIC------------FVGFQMTVGV 288

  Fly   297 --------FSLVVTTQLCIYL---FGAEQVRLEAE-RFSRLLYEVIPWQNLPPKHRKLFLFPIER 349
                    |..:|::...:||   :|  |:..:|. .||...|.. .|.....::::..:..|.|
  Fly   289 PPDIVVKLFLFLVSSMSQVYLICHYG--QLVADASYGFSVATYNQ-KWYKADVRYKRALVIIIAR 350

  Fly   350 AQRETVLGA-YFFELGRPLLVWIFRTAGSFTTLMNALYAK 388
            :|:.|.|.| .|.::.|..:..:.:.:..|..|:..:|.:
  Fly   351 SQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTMYTQ 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 32/156 (21%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 32/156 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.