DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Orco

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:287 Identity:58/287 - (20%)
Similarity:94/287 - (32%) Gaps:91/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFLGNLWTQRFTFARMGLDLQPDK----KGNVLRSPLLYCIMCLTTSFELCTVCAFMVQNRN--- 64
            |||    ..:|||..:.:.|..::    .||.:.:  |:...|:|....|.      |..:|   
  Fly    51 VFL----LMQFTFILVNMALNAEEVNELSGNTITT--LFFTHCITKFIYLA------VNQKNFYR 103

  Fly    65 QIVLCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQ--QIQSPFTEEDLVGTEWRSQNQRGQLM 127
            .:.:.::...|.|...|.....:|.|||...|..|:.  .:.|        .|.|          
  Fly   104 TLNIWNQVNTHPLFAESDARYHSIALAKMRKLFFLVMLTTVAS--------ATAW---------- 150

  Fly   128 AAIYFMMCAGTSVSFLL-------MPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAMDCC 185
            ..|.|.   |.||..::       :||.:..|         |:.||   .|::.:....|.:...
  Fly   151 TTITFF---GDSVKMVVDHETNSSIPVEIPRL---------PIKSF---YPWNASHGMFYMISFA 200

  Fly   186 LMVFVLSFFCCSTTGVDTLY-GW----C--------------ALGVSLQ-YRRLGQQLKRIPSCF 230
            ..::.:.|....:...|.:: .|    |              .|..||. ||.....|.|..|..
  Fly   201 FQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPLMELSASLDTYRPNSAALFRSLSAN 265

  Fly   231 NPSR----------SDFGLSGIFVEHA 247
            :.|.          :|..:|||:...|
  Fly   266 SKSELIHNEEKDPGTDMDMSGIYSSKA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 41/208 (20%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 51/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.