DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or83a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:362 Identity:82/362 - (22%)
Similarity:138/362 - (38%) Gaps:99/362 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LIQQIQSPFTEEDLVGTEW---RSQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEF 160
            ::..|...:.....||..:   ....:..:|....|...|...::.:|.:|:|     |....  
  Fly   118 ILSNINDEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIA-----YRDRS-- 175

  Fly   161 APVSSFRVLLPYDVTQPHVYAMDCCLMVFVL----------SF---------FCCSTTG-VDTLY 205
            .|::.:   .|:|.|||.||.     :||:|          ||         .|...:| .|.|:
  Fly   176 LPLACW---YPFDYTQPGVYE-----VVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLF 232

  Fly   206 GWCALG--VSLQYRRLG---------------------------------QQLKRIPSCFNPSRS 235
              |:|.  ::..|..:|                                 |:|.::.|..:.| |
  Fly   233 --CSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFS-S 294

  Fly   236 DFGLSGI-FVEHAR----LLKIVQHFNYS---FMEIAFVEVVIICGLYCSVICQYIMPHTNQNFA 292
            .|.||.: .::|.|    .||.::.| ||   |::|.  ||..:..|...|..:....::.....
  Fly   295 AFRLSFVRCIQHHRYIVAALKKIESF-YSPIWFVKIG--EVTFLMCLVAFVSTKSTAANSFMRMV 356

  Fly   293 FLGFFSLVVTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLG 357
            .||.:.|:|..:|.|..:.|:.|...::|....|:. .|||......|..::|.:..::|:..|.
  Fly   357 SLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWR-SPWQRHLKDVRSDYMFFMLNSRRQFQLT 420

  Fly   358 AYFFELGR--PLLVWIFR----TAGSFTTLMNALYAK 388
            |     |:  .|.|..||    ||.||.||:..:.|:
  Fly   421 A-----GKISNLNVDRFRGTITTAFSFLTLLQKMDAR 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 76/348 (22%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 71/311 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.