DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or67d

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:391 Identity:78/391 - (19%)
Similarity:132/391 - (33%) Gaps:121/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GNVLRSP------LLYCIMCLTTSFELC---TVCAFMVQNRNQIVLCSEALMHGLQMVSSLLKMA 87
            ||.:..|      |.|.:|.....|..|   |:...:|.|.:..:     ::..|.||.|.::..
  Fly    28 GNDVADPNFRMWWLTYAVMAAIAFFFACTGYTIYVGVVINGDLTI-----ILQALAMVGSAVQGL 87

  Fly    88 IFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQNQRGQLMA-------------AIYFMMCAGTS 139
            ..|..:.:....::::|:  |.||:    :|....:|...|             .|.||:     
  Fly    88 TKLLVTANNASHMREVQN--TYEDI----YREYGSKGDEYAKCLEKRIRITWTLLIGFML----- 141

  Fly   140 VSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPY----------DVTQPHV----------YAMDC 184
            |..:|:.:.:|...::.......|...:.|:|:          .:|..||          |..|.
  Fly   142 VYIILLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDM 206

  Fly   185 CLMVFVL------SFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFG----- 238
            .|.:||.      ..||...|..:.|.                          ..|:||.     
  Fly   207 YLFLFVTHVPLIKDIFCVKLTEFNELV--------------------------MKRNDFPKVRAM 245

  Fly   239 LSGIFVEHARLLKIVQHFNYSFMEIAFVEVVIIC-GLYCSVIC----------QYIMPHTNQNFA 292
            |..:.|.|....:::|.....:..:.||::...| ||.|::.|          .|::......:.
  Fly   246 LCDLLVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLLCTISCIFMKAWPAAPLYLLYAAITLYT 310

  Fly   293 FLGFFSLVVTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLG 357
            |.|..:||..:.               |.|..::|....|..||.|..||.:..:.:||.|.||.
  Fly   311 FCGLGTLVENSN---------------EDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLT 360

  Fly   358 A 358
            |
  Fly   361 A 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 66/335 (20%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 67/350 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.