DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or67c

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:322 Identity:67/322 - (20%)
Similarity:117/322 - (36%) Gaps:76/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FARMGLDLQPDKKGNVLRSPLLYCIMCLT--TSFELCTVCAFM-----VQNRNQIVLC-SEALMH 75
            :..:|.|:...:..|.|:| ||:.|....  .:|.|..:...:     :|:...|.|. :.|...
  Fly    23 YRTIGEDIYAHRSTNPLKS-LLFKIYLYAGFINFNLLVIGELVFFYNSIQDFETIRLAIAVAPCI 86

  Fly    76 GLQMVSSLLKMAIFLAKSHDLVDLIQQI----------QSPFTEEDLVGTEWRSQNQRGQLMAAI 130
            |..:|:. .|.|..:.....|:.|:..:          |..:...|...|..|..|        |
  Fly    87 GFSLVAD-FKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVIN--------I 142

  Fly   131 YFMMCAGTSVSFLLMPVALTMLKYHSTG--EFAPVSSFRVLLPYDVTQPH----VYAMDCCLMVF 189
            :..:|...:.:|...|.....:|::..|  .|.....|.:..|:|.|:.:    :...|.....:
  Fly   143 FTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFPFDATRNNLIYWIMYWDIAHGAY 207

  Fly   190 V--LSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFG-LSGIFVEHARLLK 251
            :  ::|.|     .|.|.......:.:.:..:..:|:..|...|..:.:.. |.||...|.:.||
  Fly   208 LAGIAFLC-----ADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHDKCLK 267

  Fly   252 IVQHFN--YSF----------MEIAF---------VEVVIICGLYC----------SVICQY 282
            :.:|.|  |||          |:|.|         |||:||   ||          .::|.|
  Fly   268 LCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVIII---YCIFLMTSMVQVFMVCYY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 52/254 (20%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 53/258 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.