DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or49a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:419 Identity:85/419 - (20%)
Similarity:161/419 - (38%) Gaps:84/419 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFLGNLWTQRFTFARMGLDLQPDKKGNVLRSPLLYCIMCLTTS-FELCTVCAF----MVQNRNQI 66
            :|:.|:     .|..:|.||        ..:|..:....|... |.|||:..|    ||..|   
  Fly    11 IFMANM-----MFKTLGYDL--------FHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTR--- 59

  Fly    67 VLCSEAL-----------MHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQ 120
            ::..|:|           :|...|:||.||...|:.....|:.|..:::..:..::        |
  Fly    60 IIEWESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKE--------Q 116

  Fly   121 NQRGQLMAAIYFMMCAGTSVSFL---------LMPVALTMLKY---HSTGEFAPVSSFRVLLPYD 173
            ||| :.....|::.|:..:|.::         |.|:..:.:.|   ....:|.....|...|.:|
  Fly   117 NQR-KYEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFD 180

  Fly   174 VTQPHVYAMDCCLMVFVLSFFCCSTT-GVDTLYGWCALG-VSLQYRRLGQQLKRI-PSCFNPSRS 235
            ..:|..|.: ..::.|..|.|..:.: |.| |:..|... :|:....|...|..| ||.....:.
  Fly   181 SEKPLGYVL-AYVIDFTYSQFIVNVSLGTD-LWMMCVSSQISMHLGYLANMLASIRPSPETEQQD 243

  Fly   236 -DFGLSGIFVEHARLLKIVQHFNYSF-----MEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFL 294
             || |:.|...|..::::.:..||.|     ..:.....::.|..|.:|:..:       |:..:
  Fly   244 CDF-LASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGF-------NWEGI 300

  Fly   295 GFFSLVVTTQLCIYLFGAE-QVRLE-AERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLG 357
            .:..|..:.....|:..:. |:.:: :...::..:| ..|.....:::|..|..:.:|||...:.
  Fly   301 SYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFE-SKWYEGSLRYKKEILILMAQAQRPLEIS 364

  Fly   358 AYFFELGRPLLVWIFRTAGSFTTLMNALY 386
            |      |.:::....|   |..||...|
  Fly   365 A------RGVIIISLDT---FKILMTITY 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 62/319 (19%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 62/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.