DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or43b

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:161 Identity:34/161 - (21%)
Similarity:59/161 - (36%) Gaps:56/161 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TTSFELCTVCAFMVQNRNQIVLCSEALMH-------GLQMVSSLLKMAIFLAKSH----DLVDLI 100
            |.|:.:..|.|.    |..|:|..:.:::       |....|.:.|..:...|:|    :..|.|
  Fly   204 TDSYPVIYVAAL----RTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCIKAHRTMLNFCDAI 264

  Fly   101 QQIQSPFTEEDLVGTEWRSQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSS 165
            |.|.|                  |.:.|  .|::| |:.:..:::.:.|          ||..|:
  Fly   265 QPIIS------------------GTIFA--QFIIC-GSILGIIMINMVL----------FADQST 298

  Fly   166 -FRVLLPYDVTQPHVYAMDCCLMVFVLSFFC 195
             |.::         :|.|...|..|.|.|:|
  Fly   299 RFGIV---------IYVMAVLLQTFPLCFYC 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 26/122 (21%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 34/161 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.