DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or42a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster


Alignment Length:258 Identity:47/258 - (18%)
Similarity:78/258 - (30%) Gaps:90/258 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EWRSQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVY 180
            :|||......|.|.:.:...||....                               ||      
  Fly   178 DWRSSTLHLALQAGLEYFAMAGACFQ-------------------------------DV------ 205

  Fly   181 AMDCCLMVFVLSFFCCSTTGVDTLYGWCALGVSLQYRRLG--------QQLKRIPSCFNPSRSDF 237
            .:||..:.|||......:...:.|            ||||        |:.:|:..|..      
  Fly   206 CVDCYPVNFVLVLRAHMSIFAERL------------RRLGTYPYESQEQKYERLVQCIQ------ 252

  Fly   238 GLSGIFVEHARLLKIVQHFNYSFMEIAFVEVVIICGLYC--SVICQYIMPHTNQNFAFLGFFSLV 300
                   :|..:|:.|...........||:.::: ||..  ::|...:..:.....|.|.|.:.|
  Fly   253 -------DHKVILRFVDCLRPVISGTIFVQFLVV-GLVLGFTLINIVLFANLGSAIAALSFMAAV 309

  Fly   301 V--TTQLCIY--------------LFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPI 347
            :  ||..||.              ||.:..:. |.:|:.:.|...:.....|.....:.:|||
  Fly   310 LLETTPFCILCNYLTEDCYKLADALFQSNWID-EEKRYQKTLMYFLQKLQQPITFMAMNVFPI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 47/258 (18%)
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 47/258 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.