DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or33c

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:174 Identity:45/174 - (25%)
Similarity:66/174 - (37%) Gaps:47/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 GLSGIF-----VEHARLLK-------IVQHFNYSFMEIAFVEVVII--CGLYCSVICQYIMPHTN 288
            |..|.|     |.|.|||.       :|:..|.....|:.|::|.:  ||....:|..|::....
  Fly   216 GQLGYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVG 280

  Fly   289 QNFA---FLGFFSLVVTTQLCIYLFG----AEQVRLEAERFSRLLYEVIP--WQNLPPKHR-KLF 343
            ...:   :|.||.:|     |:.||.    |.:|   ||...||.|.:..  |.:....|| .|.
  Fly   281 DTISLVYYLVFFGVV-----CVQLFPSCYFASEV---AEELERLPYAIFSSRWYDQSRDHRFDLL 337

  Fly   344 LFPIERAQRETVLGAYFFELGRPLLVWIFRTAGSFTTLMNALYA 387
            :|      .:..||    ..|     ||.:..|.....:||.:|
  Fly   338 IF------TQLTLG----NRG-----WIIKAGGLIELNLNAFFA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 41/161 (25%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 45/174 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.