DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or33b

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:345 Identity:69/345 - (20%)
Similarity:127/345 - (36%) Gaps:93/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CAFMVQNRNQ---IVLCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEW 117
            |.|..||..:   .:..|..:.:||..:|::  .::.....|   .|:.....|:   |:..|| 
  Fly   112 CEFFNQNTRREANFIWKSFIVAYGLSNISAI--ASVLFGGGH---KLLYPAWFPY---DVQATE- 167

  Fly   118 RSQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAM 182
                       .|:::     ||::.:..|:|.:|:..:...:.|::                  
  Fly   168 -----------LIFWL-----SVTYQIAGVSLAILQNLANDSYPPMT------------------ 198

  Fly   183 DCCLMVFVLSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLSG-----I 242
                       ||.               |:...|.|..:|.||..  .|..:.: |:|     .
  Fly   199 -----------FCV---------------VAGHVRLLAMRLSRIGQ--GPEETIY-LTGKQLIES 234

  Fly   243 FVEHARLLKIVQHFNYSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFA--FLG--FFSLVVTT 303
            ..:|.:|:|||:... |.|.|:.:...|..|:..|:....|:...:.|||  :.|  |.|:|:..
  Fly   235 IEDHRKLMKIVELLR-STMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMVLEL 298

  Fly   304 QLCIYLFGAEQVRLEAERFSRLLYEVIP--WQNLPPKHRKLFLFPIERAQRETVLGA-YFFELGR 365
            ..|.| :|.    |.:...::|.|.:..  |.::...:.::.|..::....|..:.| ....:|.
  Fly   299 FPCCY-YGT----LISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGM 358

  Fly   366 PLLVWIFRTAGSFTTLMNAL 385
            .......|.|.||.||..:|
  Fly   359 NAFFATVRLAYSFFTLAMSL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 56/308 (18%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 63/334 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.