DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or24a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:366 Identity:70/366 - (19%)
Similarity:133/366 - (36%) Gaps:83/366 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IVLCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEED----LVGTEWRSQNQRGQL 126
            |....:||......:.||:||........:|..||::::. .||:.    .:|.:.|......||
  Fly    69 IATALDALCPVASSILSLVKMVAIWWYQDELRSLIERVRF-LTEQQKSKRKLGYKKRFYTLATQL 132

  Fly   127 MAAIYFMMCAG--TSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLP------------YDVTQP 177
               .:.::|.|  ||.|:.:..:...:|:.....::...:.|:::.|            |.:...
  Fly   133 ---TFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYILVHW 194

  Fly   178 HVYAMDCCLMVFVLSFFCCSTTGVDTLY-GWC----ALGVSLQ--------------------YR 217
            |.|....|.:            |.|..: |:|    .|.:.||                    ..
  Fly   195 HGYITVVCFV------------GADGFFLGFCLYFTVLLLCLQDDVCDLLEVENIEKSPSEAEEA 247

  Fly   218 RLGQQLKRIPSCFNP-SRSDFGLSGIFVEHARLLKIVQHFNYSFMEI--AFVEVVIICGLYCSVI 279
            |:.::::::....|. :.....|||:.||..     :.||..|.:.|  :.|::::..||   .|
  Fly   248 RIVREMEKLVDRHNEVAELTERLSGVMVEIT-----LAHFVTSSLIIGTSVVDILLFSGL---GI 304

  Fly   280 CQYIMPHTNQNFAFLGFFSLVVTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFL 344
            ..|::            ::..|..::.:|..|...:.......:|..:. ..|.....:.:|:.|
  Fly   305 IVYVV------------YTCAVGVEIFLYCLGGSHIMEACSNLARSTFS-SHWYGHSVRVQKMTL 356

  Fly   345 FPIERAQRETVLGAYFFELGRPLLVWIFRTAGSFTTLMNAL 385
            ..:.||||...:...||......|..|.|..||...|..::
  Fly   357 LMVARAQRVLTIKIPFFSPSLETLTSILRFTGSLIALAKSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 64/342 (19%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 67/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.