DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or9a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:408 Identity:91/408 - (22%)
Similarity:162/408 - (39%) Gaps:62/408 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NLWTQRFTFARMGLDLQPDKKGN-------VLRSPL-LYCIMCLTTSFELCTVCAFMVQNRNQIV 67
            :|..|...:..||:||......|       |...|| |:.:.....:.|..|          |:.
  Fly    16 SLRVQILVYRCMGIDLWSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYIT----------QVS 70

  Fly    68 LCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRS----QNQRGQLMA 128
            |.|:.|......:.:|:|..:|.....:.|.||..|::...:|..|..:.|.    :||..|:::
  Fly    71 LLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLS 135

  Fly   129 AIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAMDCCLMVF---- 189
            ..| ..|.|.:..|..:...:.::.....|:     ...:.||::    .||..|..:::|    
  Fly   136 LTY-TRCFGLAGIFAALKPFVGIILSSIRGD-----EIHLELPHN----GVYPYDLQVVMFYVPT 190

  Fly   190 ----VLSFFCCSTTG--VDTL-----YGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLSGIF 243
                |::.:...|..  ||:|     |..||:....::|.:     .:|:.......: ||..:.
  Fly   191 YLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMI-----HLPAVGGKEELE-GLVQVL 249

  Fly   244 VEHARLLKIVQHFNYSFMEIAFVEVVI----ICGLYCSVICQYIMPHTNQNFAFLGFFSLVVTTQ 304
            :.|.:.|:|..|....:..:.|::..:    ||.:...|...:..|.:....||:|  ||::.  
  Fly   250 LLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFIAFVG--SLLIA-- 310

  Fly   305 LCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGAYFFELGRPLLV 369
            |.||....|.::..:..|...|||. .|.:..|..::..|....||||...:..||||.......
  Fly   311 LFIYSKCGENIKSASLDFGNGLYET-NWTDFSPPTKRALLIAAMRAQRPCQMKGYFFEASMATFS 374

  Fly   370 WIFRTAGSFTTLMNALYA 387
            .|.|:|.|:..::.:..|
  Fly   375 TIVRSAVSYIMMLRSFNA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 71/319 (22%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 75/333 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H62715
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009998
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.