DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or65b

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:315 Identity:62/315 - (19%)
Similarity:114/315 - (36%) Gaps:79/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 QSPFTEEDLVGTEWRSQNQRGQLMAAIYFMMC--AGTSVSFLLMPVALTMLKYHSTGEFAPVSSF 166
            :.|...|...|..|             ||:|.  ..||.||.|..:.|.::.       :|:...
  Fly   128 KGPNPVEYQTGKRW-------------YFVMAFFLATSWSFFLCILLLLLIT-------SPMWVH 172

  Fly   167 RVLLPYDVTQPH--------------VYAMDCCLMVFVLSFFCCSTTGVDTLYGWCALGVSLQYR 217
            :..||:....|.              :|.......|:.|::..|.......:|.....|:.:   
  Fly   173 QQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEV--- 234

  Fly   218 RLGQQLKRIPSCFNPSRSDFGLSGIFVEHARLLKIVQHFNYSFMEI------AFVEVVII-CGLY 275
             |..:|::|      .|.::||..:.:|..||:|:.|    ..:||      .|...:|: .|:.
  Fly   235 -LCLELRQI------HRHNYGLQELRMETNRLVKLHQ----KIVEILDRTNDVFHGTLIMQMGVN 288

  Fly   276 CSVICQYIM--------PHTNQNFAFLGFFSLVVTTQLCIYLFGAEQVRLEAERFSRLLYEVI-P 331
            .|::...::        |.....||.|   .|:....|.::.:..:|:..::.:.|...||.. |
  Fly   289 FSLVSLSVLEAVEARKDPKVVAQFAVL---MLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDP 350

  Fly   332 WQNLPPKHRKLFLFPIERAQRETVLGAYFFELGRPLLVWIFRTAGSFTTLMNALY 386
            .:.....:|.|.:. |.|.|...::.|..|    |....|     :::.::|..|
  Fly   351 TKGSKDVYRDLCVI-IRRGQDPLIMRASPF----PSFNLI-----NYSAILNQCY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 60/303 (20%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 61/313 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.