DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or2a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:402 Identity:82/402 - (20%)
Similarity:152/402 - (37%) Gaps:93/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SPLLYCIMCLTTS------FELCTVCAFMVQNRNQIVLCSEALMHGLQMVSSLLKMAIFLAKS-- 93
            |.|||.:..:|.:      |.| ::.|.::...|...||....:....:|::|....:::.:.  
  Fly    34 SSLLYVVYSITVNLVVTVLFPL-SLLARLLFTTNMAGLCENLTITITDIVANLKFANVYMVRKQL 97

  Fly    94 HDLVDLIQQIQSPFTEEDLVGTEWRSQNQRGQL---------MAAIYFMMCAGTSVSF------- 142
            |::..|::.:.:   ...|||........|.::         .|:|:..   ||::|.       
  Fly    98 HEIRSLLRLMDA---RARLVGDPEEISALRKEVNIAQGTFRTFASIFVF---GTTLSCVRVVVRP 156

  Fly   143 ---LLMPVALTMLKYHSTGEFAPVSSFRV--LLPYDVTQPHVYAMDCCLMVFVLSFFCCSTTGVD 202
               ||.|....:...|||..:..::.:::  |:        |.|:..|........|.|..||  
  Fly   157 DRELLYPAWFGVDWMHSTRNYVLINIYQLFGLI--------VQAIQNCASDSYPPAFLCLLTG-- 211

  Fly   203 TLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLS------GIFVE-----------HARLL 250
                 ....:.|:.||:|        | ...:|:.|.:      .::.|           | ||.
  Fly   212 -----HMRALELRVRRIG--------C-RTEKSNKGQTYEAWREEVYQELIECIRDLARVH-RLR 261

  Fly   251 KIVQHFNYSFMEI-AFVEVVIICGLYCSVICQYIM-----PHTNQNFAFLGFFSLVVTTQLCIYL 309
            :|:|.    .:.: ...:.|....:.|:|...::.     .||....:.: |||.|......|..
  Fly   262 EIIQR----VLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIV-FFSAVTLEVFVICY 321

  Fly   310 FGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGA-YFFELGRPLLVWIFR 373
            || :::|.::|......|: ..|....||.::..||.:.|.||.:::.| .:..|.......:.|
  Fly   322 FG-DRMRTQSEALCDAFYD-CNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMR 384

  Fly   374 -TAGSFTTLMNA 384
             |...||.|:.|
  Fly   385 FTYSVFTLLLRA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 67/344 (19%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 69/358 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.