DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or1a and Or69a

DIOPT Version :9

Sequence 1:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:339 Identity:66/339 - (19%)
Similarity:122/339 - (35%) Gaps:47/339 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQNQRGQLMAAI-- 130
            |.|.|.|.|..:|.:|....:...|:| ..:|:.:.:..|  :.:....:|..:.:.:....|  
  Fly    77 LASVASMLGFTIVGTLNLWKMLSLKTH-FENLLNEFEELF--QLIKHRAYRIHHYQEKYTRHIRN 138

  Fly   131 YFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRV----LLPYDV--TQPHVYAMDCCLMVF 189
            .|:......|.:..:|:.|.:.::.|..:   ...:|:    ..|:.|  :.|..:|...| .:|
  Fly   139 TFIFHTSAVVYYNSLPILLMIREHFSNSQ---QLGYRIQSNTWYPWQVQGSIPGFFAAVAC-QIF 199

  Fly   190 VLSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLSGIFVEHARLLKIVQ 254
            ......|....:..|..:..:.:.:.:..|.:||:.| ...||...| .|..:.|.|.:||.:..
  Fly   200 SCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETI-DARNPHAKD-QLKYLIVYHTKLLNLAD 262

  Fly   255 HFNYSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFAF-------LGFFSLVVTTQLCIYLFGA 312
            ..|.||      ....:..|..|:|....:..:...|.|       ||.. |.:|....:...|.
  Fly   263 RVNRSF------NFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLL-LFITYNFSMCRSGT 320

  Fly   313 EQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGAYFFELGRPLLVWIFRTAG- 376
            ..:....:......|.  .|......:|::.|..:.||.             :|.:...::.|. 
  Fly   321 HLILTSGKVLPAAFYN--NWYEGDLVYRRMLLILMMRAT-------------KPYMWKTYKLAPV 370

  Fly   377 SFTTLMNALYAKYE 390
            |.||.|..|...|:
  Fly   371 SITTYMATLKFSYQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 54/311 (17%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 65/336 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.