DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12470 and CG32436

DIOPT Version :9

Sequence 1:NP_569838.1 Gene:CG12470 / 30977 FlyBaseID:FBgn0040371 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_730622.1 Gene:CG32436 / 40362 FlyBaseID:FBgn0052436 Length:1737 Species:Drosophila melanogaster


Alignment Length:123 Identity:27/123 - (21%)
Similarity:50/123 - (40%) Gaps:22/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KGKGKKGKKPAAVVAPIEAPPCPPCPEPPKQMQPLDACPESSGPHDVLRA---QPNHYPALLR-- 63
            :|:|::|.:...::...|.      .|..::...|...|....|.:|.||   :|..:...:|  
  Fly  1140 EGEGEEGDEEDDMLGGEEG------EEEGEEEVELKHLPGKKLPKEVRRAYKPRPIMFGYRMREK 1198

  Fly    64 -----IPETMAVVGSENGCYDSI--CKLLR--AGFRCAERVFVMAPWGNYVVFRYHNN 112
                 |..::|:.|.:.|.:.:|  |....  |...|:.|  .:..|.:|.:.|..||
  Fly  1199 DCNFKIQGSLALEGRDEGSFKTIKPCYFASALAIISCSLR--PLNQWNSYRIDRVINN 1254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12470NP_569838.1 None
CG32436NP_730622.1 Bud13 1072..>1134 CDD:286779
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.