powered by:
Protein Alignment CG12470 and CG14402
DIOPT Version :9
Sequence 1: | NP_569838.1 |
Gene: | CG12470 / 30977 |
FlyBaseID: | FBgn0040371 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286114.1 |
Gene: | CG14402 / 35352 |
FlyBaseID: | FBgn0032894 |
Length: | 276 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 13/49 - (26%) |
Similarity: | 19/49 - (38%) |
Gaps: | 16/49 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 YFLFDGCTCDVNRFRYLDLSCGTAGFLFFDNMHDVISYIIQSRKTRLYL 165
:|||. |.. |.|.|...|.:| .|:::.||.:..|
Fly 216 FFLFH---CQA-RGRPLFKDCESA------------PYVLRMRKLQQLL 248
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0010003 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.