powered by:
Protein Alignment CG12470 and FOS
DIOPT Version :9
Sequence 1: | NP_569838.1 |
Gene: | CG12470 / 30977 |
FlyBaseID: | FBgn0040371 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005243.1 |
Gene: | FOS / 2353 |
HGNCID: | 3796 |
Length: | 380 |
Species: | Homo sapiens |
Alignment Length: | 54 |
Identity: | 16/54 - (29%) |
Similarity: | 22/54 - (40%) |
Gaps: | 12/54 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 AVVAPIEAPPCP-PCPEPPKQM-------QPLD--ACPESSGP--HDVLRAQPN 56
|...|:...|.| |..||.|.: :|.| ..|.||.| .:..|:.|:
Human 238 AFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPD 291
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2183 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.