DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12470 and FOS

DIOPT Version :9

Sequence 1:NP_569838.1 Gene:CG12470 / 30977 FlyBaseID:FBgn0040371 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_005243.1 Gene:FOS / 2353 HGNCID:3796 Length:380 Species:Homo sapiens


Alignment Length:54 Identity:16/54 - (29%)
Similarity:22/54 - (40%) Gaps:12/54 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AVVAPIEAPPCP-PCPEPPKQM-------QPLD--ACPESSGP--HDVLRAQPN 56
            |...|:...|.| |..||.|.:       :|.|  ..|.||.|  .:..|:.|:
Human   238 AFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12470NP_569838.1 None
FOSNP_005243.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..138
Basic motif, required for the activation of phospholipid synthesis, but not for CDS1-binding 139..159
bZIP_Fos 147..200 CDD:269869
coiled coil 147..199 CDD:269869
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 165..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2183
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.