DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and RSR1

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_011668.3 Gene:RSR1 / 853056 SGDID:S000003384 Length:272 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:81/245 - (33%)
Similarity:121/245 - (49%) Gaps:16/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMR 112
            :|:||:|:..|||:.:..||:...:...|..|||:.::....|......|:||||||..:|.|||
Yeast     4 YKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAMR 68

  Fly   113 ALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGETEREVEYA 177
            .|.|.|...|:|||.|||..:.||:..:|:|:...|.:..||:|::|||.||:    .||.:   
Yeast    69 ELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLI----NERVI--- 126

  Fly   178 TTESVVTVDWENG---FVEASASSNENITQVFKELLAQAKITYNLSPALRRRRQSLPQQIGNNGP 239
            :.|..:.|..:.|   |.|.||....|:.:||.:|:.|.......|.|::..|....|......|
Yeast   127 SVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVKDARNQSQQFSKIESP 191

  Fly   240 ST--PLHHHQHTQHHN----SGGGTSASTSSAAAAASSSGGSGSHAPTPA 283
            ||  |....|.|:..|    |.|..:.|:...|....|:..:..|.|:.|
Yeast   192 STRLPSSAKQDTKQSNNKQSSKGLYNKSSQGQAKVKQSTPVNEKHKPSHA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 62/169 (37%)
Ras_dva 49..239 CDD:206714 66/192 (34%)
RSR1NP_011668.3 RSR1 3..166 CDD:133377 62/168 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.