DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and rasd1

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001072408.1 Gene:rasd1 / 779862 XenbaseID:XB-GENE-483475 Length:266 Species:Xenopus tropicalis


Alignment Length:194 Identity:80/194 - (41%)
Similarity:119/194 - (61%) Gaps:13/194 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IGPANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGS 105
            |.|.|. :::|::||:|||||||:::||...|..:|..|||:.|:..:||.|....||||||:|:
 Frog    14 IPPKNC-YRMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIEDFHRKFYSIRGEVYQLDILDTSGN 77

  Fly   106 YEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKA--------TTAVPIVVVGNKI 162
            :.|||||.|||.:.|.||||:.:.:..:||||:.::.||.|||:        ...||||:.|||:
 Frog    78 HPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKNKTKENVDVPIVICGNKV 142

  Fly   163 DLLADGETEREVEYATTESVVTVDWENGFVEASASSNENITQVFKELLAQAKITYNLSPALRRR 226
                |.:..|||:....|.:|..|.:..:.|.||..|.::.::||.|...||:...:||.|.|:
 Frog   143 ----DRDFYREVQPHEIEQLVGEDSKCSYFEVSAKKNSSLDEMFKALFTMAKLPSEMSPDLHRK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 72/174 (41%)
Ras_dva 49..239 CDD:206714 77/186 (41%)
rasd1NP_001072408.1 Rhes_like 20..266 CDD:133343 77/187 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.