DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and Rasd1

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001257883.1 Gene:Rasd1 / 64455 RGDID:619727 Length:280 Species:Rattus norvegicus


Alignment Length:287 Identity:94/287 - (32%)
Similarity:142/287 - (49%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYE 107
            ||...:::|::||:|||||:|:::||...|...|..|||:.|:..:||.|....||||||:|::.
  Rat    20 PAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHP 84

  Fly   108 FPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQI--------HETKATTAVPIVVVGNKIDL 164
            |||||.|||.:.|.||||:.:.:..:||||:.::.||        ::||....||:|:.|||   
  Rat    85 FPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNK--- 146

  Fly   165 LADGETEREVEYATTESVVTVDWEN-GFVEASASSNENITQVFKELLAQAKITYNLSPALRRRRQ 228
             .|.:..||||....|.:|..|.:. .:.|.||..|.::.|:|:.|.|.||:...:||.|.|:..
  Rat   147 -GDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVS 210

  Fly   229 SLPQQIGNNGPSTPLHHHQHTQHHNSGGGTSASTSSAAAAASSSGGSGSH----------APTPA 283
            .....:        ||              ..:..:.....:.|||.|.|          |..|:
  Rat   211 VQYCDV--------LH--------------KKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPS 253

  Fly   284 QLQHLQRIQER----SLGAKRNSCIIS 306
            ....|..|:|:    |....:..|:||
  Rat   254 VHSDLMYIREKTSVSSQAKDKERCVIS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 71/175 (41%)
Ras_dva 49..239 CDD:206714 76/198 (38%)
Rasd1NP_001257883.1 Rhes_like 25..280 CDD:133343 90/280 (32%)
Effector region 53..61 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.