DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and rasd2

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001025373.1 Gene:rasd2 / 565976 ZFINID:ZDB-GENE-050913-57 Length:335 Species:Danio rerio


Alignment Length:278 Identity:76/278 - (27%)
Similarity:125/278 - (44%) Gaps:60/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KDDNAEDKPKRD----------KVGRNNAVDD---AIGPANARHKIVVMGSAKVGKTSIITQFL- 68
            :..::|.||:|.          |..|....:|   ::.|::.| ::||:|:.:||||::|.:|| 
Zfish    53 RPSSSERKPRRSLDPLSQLHKTKHMRYEVKNDELVSVKPSHYR-RVVVLGAPRVGKTALIRRFLG 116

  Fly    69 YNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATT 133
            ...|...|:.|.|:.|...:.|.|....|||||.:...:|||.|.|:|.:.|.|:||:.|||..:
Zfish   117 EEVFEEHYEPTSEDFHSKLYHIRGERYQLDILDASKERDFPAKRRLTILTGDIFLLVFSVTDRDS 181

  Fly   134 FEEVRTIRDQIH-------ETKATTAVPIVVVGNKIDLLADGETEREVEYATTESVVTVDWENGF 191
            ..||.::|::|.       ::|....:||::..||    ||.::.|.|:.:.....:..|  :..
Zfish   182 LTEVCSLREEIFTAKSKLTKSKENRQLPIIICANK----ADVDSPRAVQRSDVAQCLGED--SVL 240

  Fly   192 VEASASSNENITQVFKELLAQAKITYNLSPALRR------------------------------- 225
            .|.||.:..|:.:||:.|.....:.....|:|.|                               
Zfish   241 FEVSAKTCTNLEEVFEALAVLGGLPTETRPSLHRDISIHTYHALSSRKRNKRAVNEPCGAVHPLA 305

  Fly   226 RRQSLPQQIGN-NGPSTP 242
            ||.|....:.. .|||||
Zfish   306 RRPSFSSDLRRVLGPSTP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 56/174 (32%)
Ras_dva 49..239 CDD:206714 62/229 (27%)
rasd2NP_001025373.1 Rhes_like 95..335 CDD:133343 68/236 (29%)
RAS 95..258 CDD:214541 56/169 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.