DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and RASD1

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_057168.1 Gene:RASD1 / 51655 HGNCID:15828 Length:281 Species:Homo sapiens


Alignment Length:287 Identity:96/287 - (33%)
Similarity:144/287 - (50%) Gaps:48/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYE 107
            ||...:::|::||:|||||:|:::||...|...|..|||:.|:..:||.|....||||||:|::.
Human    20 PAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHP 84

  Fly   108 FPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQI--------HETKATTAVPIVVVGNKIDL 164
            |||||.|||.:.|.||||:.:.:..:||||:.:|.||        ::||....||:|:.|||   
Human    85 FPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNK--- 146

  Fly   165 LADGETEREVEYATTESVVTVDWEN-GFVEASASSNENITQVFKELLAQAKITYNLSPALRRRRQ 228
             .|.:..|||:....|.:|..|.:. .:.|.||..|.::.|:|:.|.|.||:...:||.|.|:..
Human   147 -GDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVS 210

  Fly   229 SLPQQIGNNGPSTPLHHHQHTQHHNSGGGTSASTSSAAAAASSSGGSGS----------HAPTPA 283
            .....:        ||             ..|..:.....|.|.||.|.          .|..|:
Human   211 VQYCDV--------LH-------------KKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPS 254

  Fly   284 QLQHLQRIQER-SLGAK---RNSCIIS 306
            ....|..|:|: |.|::   :..|:||
Human   255 VHSDLMYIREKASAGSQAKDKERCVIS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 71/175 (41%)
Ras_dva 49..239 CDD:206714 76/198 (38%)
RASD1NP_057168.1 Rhes_like 25..281 CDD:133343 92/280 (33%)
Effector region 53..61 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.