DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and CG30158

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster


Alignment Length:258 Identity:89/258 - (34%)
Similarity:133/258 - (51%) Gaps:63/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAM 111
            |.::|::|.|.|||:||:.:||:.|::.||:.|:|:::...:.:.||:|.:|||||:|..:||||
  Fly     6 RIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAM 70

  Fly   112 RALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKAT-TAVPIVVVGNKIDLLADGETEREVE 175
            |.|||::|.||:|||..|.|.:|:.|:...::|.|.:.. ..:|||:.|||.||   ..|.|||:
  Fly    71 RRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADL---ATTHREVK 132

  Fly   176 YATTESVVTVDW--------ENGFVEASASSNENITQVFKELLAQAKITYNLSPALRRRRQSLPQ 232
               .|.|  .||        ....:|.||..:.|:|.:||.||:.::.              ||.
  Fly   133 ---LEEV--TDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRF--------------LPA 178

  Fly   233 QIGNNGPSTPLHHHQHTQHHNSGGGTSAST-----SSAAAAASSS--------------GGSG 276
            ....:|.|             .|||.:|.:     |||..:||||              ||||
  Fly   179 SSSGSGGS-------------GGGGEAAPSGFKRRSSAYVSASSSRNKNRMNSPALGGAGGSG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 69/175 (39%)
Ras_dva 49..239 CDD:206714 71/198 (36%)
CG30158NP_652315.2 Ras 8..172 CDD:206642 69/171 (40%)
Ras 8..170 CDD:278499 67/169 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113652at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16914
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.