DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and Ras85D

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster


Alignment Length:172 Identity:59/172 - (34%)
Similarity:94/172 - (54%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMR 112
            :|:||:|:..|||:::..|.:.|.|..:|..|||:.::....|.|.:..||||||||..|:.|||
  Fly     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68

  Fly   113 ALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLA---DGETEREV 174
            ...:.:.:.|:||:.|..|.:||::.|.|:||...|....||:|:||||.||.:   :.|..|||
  Fly    69 DQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWNVNNEQAREV 133

  Fly   175 --EYATTESVVTVDWENGFVEASASSNENITQVFKELLAQAK 214
              :|...           ::|.||.:...:...|..|:.:.:
  Fly   134 AKQYGIP-----------YIETSAKTRMGVDDAFYTLVREIR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 59/172 (34%)
Ras_dva 49..239 CDD:206714 59/171 (35%)
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 59/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453073
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.