DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and CG8519

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster


Alignment Length:189 Identity:48/189 - (25%)
Similarity:93/189 - (49%) Gaps:20/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTA--GSYEFPAM 111
            ||.|:|:..|||:::|.:||...:..:|....|..::....:.|..:..:||||.  ...|:|..
  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYPNA 81

  Fly   112 RALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGETEREVEY 176
            ..| :..||..:|||.:||..:|..:|..:..:.     :..|:.:..||:|::...:..|:   
  Fly    82 AEL-VQWADGLLLVYSITDRKSFNYIRRAKSDLQ-----SDTPVQLCANKVDMVHLRQVSRD--- 137

  Fly   177 ATTESVVTVDWENGFVEASASSN-ENITQVFKELLAQAKITYNLSPALRRRRQSLPQQI 234
              ...::..|:|..|.|.||:.: :.:.:||.||..:      :..:.|:.:|||.:::
  Fly   138 --EGEILAKDFECKFSEVSAADHVDQVAEVFNELCKE------VLASKRKSKQSLLERM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 44/168 (26%)
Ras_dva 49..239 CDD:206714 48/189 (25%)
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 44/172 (26%)
P-loop_NTPase 17..173 CDD:304359 44/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452984
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.