DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and Ric

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001163165.1 Gene:Ric / 36776 FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster


Alignment Length:238 Identity:71/238 - (29%)
Similarity:114/238 - (47%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSFMKDDNAEDKPKRDKVGRNNAVDDAIGPANAR-----HKIVVMGSAKVGKTSIITQFLYNTFS 73
            ||..:|:.:..||            ..:.|.|.|     :|||::|...|||:::..||:.::|.
  Fly    33 PSDHRDNGSLIKP------------PPVPPQNMRGGLRVYKIVILGDGGVGKSAVTLQFVSHSFL 85

  Fly    74 TKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVR 138
            ..:..|||:.:|....|...:..||||||||..||.|||...:...:.||:.|.|||..:|:|..
  Fly    86 DYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFTAMRDQYMRCGEGFIICYSVTDRHSFQEAS 150

  Fly   139 TIRDQIHETKATTAVPIVVVGNKIDLLADGETEREVEYATTESVVTVDWENG--FVEASASSNEN 201
            ..|..|...:.:..:|:|::.||:||    |::|.|   |||....:..:.|  |.|.||:....
  Fly   151 EYRKLITRVRLSEDIPLVLIANKVDL----ESQRRV---TTEEGRNLANQFGCPFFETSAALRHY 208

  Fly   202 ITQVFKELLAQAKITYNLSPALRRRRQSLPQQIGNNGPSTPLH 244
            |.:.|..|:.:.            ||:.:.:.:|.:..|..:|
  Fly   209 IDEAFYTLVREI------------RRKEMHKALGTDSNSEKIH 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 58/168 (35%)
Ras_dva 49..239 CDD:206714 61/191 (32%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 60/189 (32%)
small_GTPase 58..223 CDD:197466 59/183 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.