DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and Rala

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:173 Identity:55/173 - (31%)
Similarity:99/173 - (57%) Gaps:7/173 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GPANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSY 106
            ||  |.||::::||..|||:::..||:|:.|...|:.|..:.::....:.|..:.:|||||||..
  Fly     8 GP--ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQE 70

  Fly   107 EFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGETE 171
            ::.|:|.....|.:.|:.|:.:||..:|:..:..|:||...|...::|.::||||.||    ..:
  Fly    71 DYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDL----NDK 131

  Fly   172 REVEYATTESVVTVDWENGFVEASASSNENITQVFKELLAQAK 214
            |:|..:..: :....|...:||.||.:.||:.:||.:|:.:.:
  Fly   132 RKVPLSECQ-LRAQQWAVPYVETSAKTRENVDKVFFDLMREIR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 52/167 (31%)
Ras_dva 49..239 CDD:206714 51/166 (31%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 52/167 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.