DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and RASD2

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_016884190.1 Gene:RASD2 / 23551 HGNCID:18229 Length:278 Species:Homo sapiens


Alignment Length:192 Identity:74/192 - (38%)
Similarity:119/192 - (61%) Gaps:11/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYE 107
            ||...:::||:|:::|||:||:::||...|..:|..|||:.|:..::|.|....||||||:|::.
Human    27 PAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHP 91

  Fly   108 FPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQI--------HETKATTAVPIVVVGNKIDL 164
            |||||.|||.:.|.||||:.:.:..:|:||:.::.||        ::||....:|:|:.|||.| 
Human    92 FPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKND- 155

  Fly   165 LADGETEREVEYATTESVVTVDWENGFVEASASSNENITQVFKELLAQAKITYNLSPALRRR 226
              .||..|:|.....|.:|:.|....:.|.||..|.|:.::|..|.:.||:.:.:||||.|:
Human   156 --HGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 66/174 (38%)
Ras_dva 49..239 CDD:206714 72/186 (39%)
RASD2XP_016884190.1 Rhes_like 32..278 CDD:133343 72/187 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.