DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and Rasd1

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_033052.1 Gene:Rasd1 / 19416 MGIID:1270848 Length:280 Species:Mus musculus


Alignment Length:287 Identity:95/287 - (33%)
Similarity:146/287 - (50%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYE 107
            ||...:::|::||:|||||:|:::||...|...|..|||:.|:..:||.|....||||||:|::.
Mouse    20 PAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHP 84

  Fly   108 FPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQI--------HETKATTAVPIVVVGNKIDL 164
            |||||.|||.:.|.||||:.:.:..:||||:.::.||        ::||....||:|:.|||   
Mouse    85 FPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNK--- 146

  Fly   165 LADGETEREVEYATTESVVTVDWEN-GFVEASASSNENITQVFKELLAQAKITYNLSPALRRRRQ 228
             .|.:..||||....|.:|..|.:. .:.|.||..|.::.|:|:.|.|.||:...:||.|.|:..
Mouse   147 -GDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVS 210

  Fly   229 SLPQQIGNNGPSTPLHHHQHTQHHNSGGGTSASTSSAAAAASSSGGSGSH----------APTPA 283
            .....:        ||              ..:..:.....:.|||.|.|          |..|:
Mouse   211 VQYCDV--------LH--------------KKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPS 253

  Fly   284 QLQHLQRIQER-SLGAK---RNSCIIS 306
            ....|..|:|: |:|::   :..|:||
Mouse   254 VHSDLMYIREKTSVGSQAKDKERCVIS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 71/175 (41%)
Ras_dva 49..239 CDD:206714 76/198 (38%)
Rasd1NP_033052.1 Rhes_like 25..280 CDD:133343 91/280 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.