DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and ssr-2

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_508490.4 Gene:ssr-2 / 191965 WormBaseID:WBGene00006055 Length:335 Species:Caenorhabditis elegans


Alignment Length:235 Identity:90/235 - (38%)
Similarity:126/235 - (53%) Gaps:30/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAM 111
            |:::||:||||||||:||.::|||.||:|||.|||::|...|.|.||.|.||||||  ::.||.|
 Worm    20 RYRLVVLGSAKVGKTNIIRRYLYNEFSSKYKETIEDLHSREFRIQGVPLPLDILDT--NFNFPDM 82

  Fly   112 RALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKA-TTAVPIVVVGNKIDLLADGETEREVE 175
            |.|||:||.||:||:.|.|.|:|:|:..|..:|...:: ...:||||||||.|:      |.:..
 Worm    83 RRLSIASASAFLLVFSVDDVTSFKEMSDIWQEICSRRSDLNELPIVVVGNKCDV------ENKKI 141

  Fly   176 YATTESVVT--VDWENGFVEASASSNENITQVFKELL------------------AQAKITYNLS 220
            |..|....|  :..:..::|.||..|..||.||:.||                  |:.:.|.: |
 Worm   142 YEETAKAFTNRLSSDVRYIEVSAKDNIRITDVFRTLLELSGFPRCKAGGGRLDDVAEDEETRS-S 205

  Fly   221 PALRRRRQSLPQQIGNNGPSTPLHHHQHTQHHNSGGGTSA 260
            |::||......:......|...|...:........|..||
 Worm   206 PSIRRSATVRAKSTTRRDPRKTLMEDEKNTASTKNGSQSA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 79/187 (42%)
Ras_dva 49..239 CDD:206714 84/210 (40%)
ssr-2NP_508490.4 P-loop_NTPase 22..178 CDD:393306 76/163 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I3196
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H78377
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16914
SonicParanoid 1 1.000 - - X5242
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.