DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13375 and D1081.4

DIOPT Version :9

Sequence 1:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_492298.3 Gene:D1081.4 / 183928 WormBaseID:WBGene00008382 Length:221 Species:Caenorhabditis elegans


Alignment Length:216 Identity:63/216 - (29%)
Similarity:110/216 - (50%) Gaps:32/216 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KPKRDKVGRNNAVDDAIGPANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFS 89
            ||:.|:  |.|.|           .:.|:|:.:|||:::::|||::.|...|:.|:||.:...:.
 Worm    13 KPRGDR--RQNKV-----------TVAVLGAERVGKSAMVSQFLWHKFVEDYRPTVEEFNWIEYE 64

  Fly    90 I-AGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAV 153
            | .|..|.:.|:|::||.:|..|:.|.|.:||||::|:...||::.||..:....||..:. .:|
 Worm    65 IEEGRVLMVQIIDSSGSRDFIGMKNLYIGTADAFLVVFAADDASSLEEALSTLSDIHARRG-NSV 128

  Fly   154 PIVVVGNKIDLLADGETEREVEYATTESVVTVDWENGFVEASASSNENITQVFKELLAQAKITYN 218
            |:::|.||.|                :..::.......:|..|...|.:...|.|:|.:.:...|
 Worm   129 PVLLVANKTD----------------KPCLSCCASKSNMECCALREEEVRACFHEILLRTRPNLN 177

  Fly   219 LSP-ALRRRRQSLPQQIGNNG 238
            :.. .||:||||:|...|.:|
 Worm   178 IQGFELRKRRQSMPSSRGYSG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13375NP_001162628.1 RAS 48..215 CDD:214541 47/167 (28%)
Ras_dva 49..239 CDD:206714 57/192 (30%)
D1081.4NP_492298.3 P-loop_NTPase 24..>138 CDD:304359 40/114 (35%)
RHO 27..167 CDD:197554 45/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.