DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ewg and MESR3

DIOPT Version :9

Sequence 1:NP_001245444.1 Gene:ewg / 30975 FlyBaseID:FBgn0005427 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001260541.1 Gene:MESR3 / 35116 FlyBaseID:FBgn0032694 Length:299 Species:Drosophila melanogaster


Alignment Length:282 Identity:60/282 - (21%)
Similarity:99/282 - (35%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 APAGSQRSSTGN--------VVVTTTSSGSHSSNGANGGTGGTSAGSSTLGSGLNVTTITATSGG 67
            ||.......||:        ::....|:.||||...:...|.||..::   |.::..||      
  Fly    20 APPSESSEGTGSSLEPRDELILHPDWSAHSHSSAQRSSAHGTTSLYNA---SDIDADTI------ 75

  Fly    68 QLQSAGNTSQSNGTTYKIEMLEEDIQSLGSDDDDEDLISSD-GSLYEGDLGSMPVNDDVAHQLAA 131
               |...||.:|.:.|:...:|.....||:    |..:|.. .:||||      ..:|...:|..
  Fly    76 ---STDTTSNTNLSDYERGQVESFFGGLGT----EIFVSGALANLYEG------TGNDGDWRLVF 127

  Fly   132 AG-PV-----GVAAAAAI--ASSKKRKRPHCFE--------------TNPS----VRKRQQNRLL 170
            .| ||     |.:.|.||  .:....:|..||.              ..||    .|.....:::
  Fly   128 TGIPVILHDKGNSKARAIPRVTLVLAERGSCFALWSDRIDNLSNYRIAGPSFHTMCRSSNHQQMI 192

  Fly   171 ----------RKLRAIIYEFTGRVGKQAVVLVATPGKPNTSYKVFGA--KPLEDV-----LRNLK 218
                      |:|...:.........:|:.:..| .||....:|..|  .|...:     ..::.
  Fly   193 GFSFDSTDAARELWQHVERLVSNPENEALTVAGT-RKPKKQKRVKPAPLPPKSQISHPCQFHHVT 256

  Fly   219 NIVMDELDNALAQQA--PPPPQ 238
            ::|.::.:...:.||  ||.||
  Fly   257 SVVKEDSERYYSMQAFGPPNPQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ewgNP_001245444.1 Nrf1_DNA-bind 145..347 CDD:287464 22/131 (17%)
Nrf1_activ_bdg 637..>672 CDD:256023
MESR3NP_001260541.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20338
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.