DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cin and moc-2

DIOPT Version :9

Sequence 1:NP_477030.1 Gene:cin / 30973 FlyBaseID:FBgn0000316 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001370857.1 Gene:moc-2 / 189078 WormBaseID:WBGene00003385 Length:168 Species:Caenorhabditis elegans


Alignment Length:174 Identity:78/174 - (44%)
Similarity:104/174 - (59%) Gaps:20/174 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLTISDTCWQEPEKDTSGPILRQLIGETFANTQVIGN-----IVPDEKDIIQQ---ELRKWIDRE 64
            |:|:||||......|.|||.|.:|: :|.|......|     :|||:...|..   |..|:.|  
 Worm     5 VITVSDTCSAGTRTDESGPKLVELV-DTSAVVNATVNEGSPFVVPDDVTAIHDALVEQSKFAD-- 66

  Fly    65 ELRVILTTGGTGFAPRDVTPEATRQLLEKECPQLSMYITLESIKQTQYAALSRGLCGIAGNTLIL 129
               ||||||||||||||||||||.:::::.|..|.:.:...|:|.|..|||||.:.||.|.|||:
 Worm    67 ---VILTTGGTGFAPRDVTPEATLKVIDRRCSGLEIALHTASLKITSMAALSRAIVGIRGGTLIV 128

  Fly   130 NLPGSEKAVKECFQTISALLPHAVHLI--GDDVSLVRKTHAEVQ 171
            |:|||.||||||:.|:..||.|.::|:  .||.|    .||.::
 Worm   129 NMPGSVKAVKECWDTLEPLLNHGINLLKNTDDGS----QHARMK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cinNP_477030.1 MogA_MoaB 4..156 CDD:238451 72/155 (46%)
MoeA 198..595 CDD:223380
MoeA 211..592 CDD:238452
moc-2NP_001370857.1 MogA_MoaB 1..155 CDD:238451 72/155 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I3649
eggNOG 1 0.900 - - E1_COG0303
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5710
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3940
SonicParanoid 1 1.000 - - X2231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.