DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13377 and CG8888

DIOPT Version :9

Sequence 1:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:356 Identity:91/356 - (25%)
Similarity:143/356 - (40%) Gaps:81/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FQLLALFSIA--GALLIYLICKVREDSASANADSHPSRVVLITSADTALGLQLCTHLANKGYRVF 73
            |.:...|::|  ||:|.|...||   |||...       ||||..:..|...|...|.:.|:.|:
  Fly    69 FAVFVWFALATVGAVLFYHFVKV---SASGKG-------VLITGCEAPLAWYLAKKLDDLGFTVY 123

  Fly    74 AGMK-EAQDSLPAKLLCGWMKIREYSEEPIAGTIIPMRLDVTREDVLREATVIIGANLNADERGI 137
            ||.. ..::|..||:|          :|..:|.:..:.||||.|..:.||...:..:|.....|:
  Fly   124 AGFNTPIEESDEAKIL----------KEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGL 178

  Fly   138 AAVINTSGSVFRGQVESQNVQQWEHMLRTNILGTLRVAKAFVCFLRPTRGRLLYLGGVSGGGNAR 202
            .:|::.:..:..|::|..........|..|:||:.|:.:.|:..:|...||:::|  .||.....
  Fly   179 WSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFL--TSGLNRVP 241

  Fly   203 NEGDGLVAFNASRVAVDKCAEELRKELHPYG--VSVVAL-------------------------- 239
            :...|:..  |::.|||..|..||:|:...|  |||||.                          
  Fly   242 SPVRGIQC--ATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQMWNQL 304

  Fly   240 -----DTCGMTAESLYKAPVAQTMSLVVGAPTQYTADVLSPDALHVIERALWDYVPQQRYALLSH 299
                 .|.|   |..|:|.:..     |...::..||:  ...|.|:..|:....|..||.    
  Fly   305 SSEQKKTYG---EDYYEAAMTS-----VEKYSRQAADI--QPTLRVLIDAVTRTFPMARYT---- 355

  Fly   300 NKYQFALPCRSSLRLQRPVASTVGESASQSV 330
                   |..||.|||..:|..:..|..:|:
  Fly   356 -------PVTSSERLQIFLAEHLAPSLYESL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 58/233 (25%)
NADB_Rossmann 46..>237 CDD:304358 53/193 (27%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 79/326 (24%)
adh_short 96..293 CDD:278532 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.