DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and SUVH3

DIOPT Version :10

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_565056.1 Gene:SUVH3 / 843641 AraportID:AT1G73100 Length:669 Species:Arabidopsis thaliana


Alignment Length:300 Identity:81/300 - (27%)
Similarity:129/300 - (43%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1338 GFNMQMRSFRP-LGLRTFVVCADASNGREARPIQVVRNELAMSENEDEA-----DSLMWPDFRYV 1396
            ||...::.::. |..|..::..|.::|.|::|:.:|.:   :.|::..|     .||.:.:...:
plant   364 GFWKSVQKWKEGLTTRPGLILPDLTSGAESKPVSLVND---VDEDKGPAYFTYTSSLKYSETFKL 425

  Fly  1397 TQCIIQQNSVQIDRRVSQMRICSCLDSCS--SDRCQCNGASSQNWYTAESRLNADFNYEDPAVIF 1459
            ||.:|.               |||..|||  :..|.|...:..:.    ..||.........||:
plant   426 TQPVIG---------------CSCSGSCSPGNHNCSCIRKNDGDL----PYLNGVILVSRRPVIY 471

  Fly  1460 ECNDVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEIL-TAME 1523
            ||...|.|: .||||||:|.|.::.|::.:..:  :|||:|:..::..|:|:..|.||:. ....
plant   472 ECGPTCPCH-ASCKNRVIQTGLKSRLEVFKTRN--RGWGLRSWDSLRAGSFICEYAGEVKDNGNL 533

  Fly  1524 ADRRTDDSYYFD------------------------------LDNGHCIDANYYGNVTRFFNHSC 1558
            ...:.:|:|.||                              |.:...|.|..:|||.||.||||
plant   534 RGNQEEDAYVFDTSRVFNSFKWNYEPELVDEDPSTEVPEEFNLPSPLLISAKKFGNVARFMNHSC 598

  Fly  1559 EPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDYG 1598
            .|||....|..|........||||:.|.|....|:.:|||
plant   599 SPNVFWQPVIREGNGESVIHIAFFAMRHIPPMAELTYDYG 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
SET_EHMT 1391..1622 CDD:380941 67/240 (28%)
SUVH3NP_565056.1 SRA 203..359 CDD:197742
SET 410..638 CDD:394802 68/249 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.