DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and ASHH3

DIOPT Version :10

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_566010.1 Gene:ASHH3 / 819021 AraportID:AT2G44150 Length:363 Species:Arabidopsis thaliana


Alignment Length:265 Identity:62/265 - (23%)
Similarity:104/265 - (39%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1374 NELAMSENEDEADSLMWPDFRYVTQCIIQQNSV----QIDRRVSQMRI-CSCLDS--------CS 1425
            |::..||   |.:...|.:....|..|..:.::    ::.|||....| |||..|        |.
plant    22 NQIGESE---EFELPEWLNKGKPTPYIFIRRNIYLTKKVKRRVEDDGIFCSCSSSSPGSSSTVCG 83

  Fly  1426 SDRCQCNGASSQNWYTAESRLNADFNYEDPAVIF-ECNDVCGCNQLSCKNRVVQNGTRTPLQIVE 1489
            |: |.|                        .::| .|:..|.|.. .|.|:..|......:::::
plant    84 SN-CHC------------------------GMLFSSCSSSCKCGS-ECNNKPFQQRHVKKMKLIQ 122

  Fly  1490 CEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADRRT-------DDSYYF-DLDNGHCIDANY 1546
            .|  ..|.|:.|...:..|.|:..|.||::.....:.|.       :.::|. ::.....|||.:
plant   123 TE--KCGSGIVAEEEIEAGEFIIEYVGEVIDDKTCEERLWKMKHRGETNFYLCEITRDMVIDATH 185

  Fly  1547 YGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDYGEKFWRVE---HRS 1608
            .||.:|:.||||.||....:...:.:    .:|..|:.|.|..||.:.:||....:..:   |..
plant   186 KGNKSRYINHSCNPNTQMQKWIIDGE----TRIGIFATRGIKKGEHLTYDYQFVQFGADQDCHCG 246

  Fly  1609 CVGCR 1613
            .||||
plant   247 AVGCR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
SET_EHMT 1391..1622 CDD:380941 57/248 (23%)
ASHH3NP_566010.1 SET_ASHR3-like 117..255 CDD:380952 36/141 (26%)
Tudor_Agenet_AtEML-like 313..362 CDD:410475
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.